PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G086300.1
Common NameB456_013G086300, LOC105782272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 357aa    MW: 39281.6 Da    PI: 7.9568
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G086300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.7e-344498155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+WtpeLH+rFv+av+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Gorai.013G086300.1 44 KPRLKWTPELHQRFVDAVNQLGGPDKATPKSVMRVMGIPGLTLYHLKSHLQKYRL 98
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.01641101IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-324298IPR009057Homeodomain-like
SuperFamilySSF466895.73E-174398IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-244499IPR006447Myb domain, plants
PfamPF002495.0E-104697IPR001005SANT/Myb domain
PfamPF143792.2E-21135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MVSTKKGSKT TYEIQFPACL SYINLVLQNT QNQRMNLVLS TDAKPRLKWT PELHQRFVDA  60
VNQLGGPDKA TPKSVMRVMG IPGLTLYHLK SHLQKYRLGK SLGDNTDYKE MQSSNGNFIR  120
DTSDGIHGHM NESLQIPQAL QMQMEVQQKL NEQIEVQRHL QLRIEAQGKY LQTVLKKAQE  180
TLAGYSSSSA GAELARAELS QLVSMVNTGC TSSSFSELTE VGGSSIIERK PMRGTICSMG  240
SSLTSSESSG RNDKAPLENG NICTQNVEFS LMDIHPEKKP LISCASNQAN GKKRSVSKVS  300
DGVCVEQPLA KRLELPEEET GGCLRKSGFL ELFDLNSQCH NDIESGPKAI DLNCRE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5789861e-98JX578986.1 Gossypium hirsutum clone NBRI_GE11130 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462358.10.0PREDICTED: uncharacterized protein LOC105782272 isoform X1
TrEMBLA0A0D2VCG30.0A0A0D2VCG3_G
STRINGVIT_01s0026g02550.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.13e-89G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]